Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C4b-binding protein (Fragment)
  • GlycoProtDB:GPDB0002353
  • UniProt:E9PUZ8
  • Gene Symbol: C4bp
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
74 ---
227 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MCAKQQQTLLPTRAAHGRLHRNRDAVAWPFSTLCRVSGPTLFQMTFTAALWVAVFGKCGPPPAIPNALPASDVNRTDFESHTTLKYECLPGYGRGISRMMVYCKPSGEWEISVSCAKKHCRNPGYLDNGYVNGETITFGSQIEFSCQEGFILVGSSTSSCEVRGKGVAWSNPFPECVIVKCGPPPDISNGKHSGTEDFYPYNHGISYTCDPGFRLVGSPFIGCTVVNKTVPVWSSSPPTCEKIICSQPNILHGVIV

Feature

GlyTouCan Images

No data