Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Advanced glycosylation end product-specific receptor variant 6
  • GlycoProtDB:GPDB0002648
  • UniProt:F1ABS2
  • Gene Symbol: Ager
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
80 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGRPRKARRMRRNVQS

Feature

GlyTouCan Images

No data