Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Beta-1,4-galactosyltransferase 4
  • GlycoProtDB:GPDB0002651
  • UniProt:F2Z3X1
  • Gene Symbol: B4galt4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
220 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGCNPPYHLSYRLRLLLLFTLCLTVVGWATSNYFVGAIQVIPKAKDFMASFHKVIHLGNEETLGHDGATKKPELANCPSVSPNLRGQSKLVFKPDLTLEEIEAENPKVSRGRYHPEECKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFLKG

Feature

GlyTouCan Images

No data