Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD180 antigen
  • GlycoProtDB:GPDB0002652
  • UniProt:F2Z425
  • Gene Symbol: Cd180
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
78 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAPDISCFFLVALFLASCRATTSSDQKCIEKEVNKTYNCENLGLNEIPGTLPNSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTR

Feature

GlyTouCan Images

No data