Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C4b-binding protein (Fragment)
  • GlycoProtDB:GPDB0002666
  • UniProt:F6QLW4
  • Gene Symbol: C4bp
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
62 17406563
22823882
23002422
110 17406563
22823882
23002422
188 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XVAWSNPFPECVIVKCGPPPDISNGKHSGTEDFYPYNHGISYTCDPGFRLVGSPFIGCTVVNKTVPVWSSSPPTCEKIICSQPNILHGVIVSGYKATYTHRDSVRLACLNGTVLRGRHVIECQDCDLPPAIVNGYYTSMVYSKITLVTYECDKGYRLVGKAIISCSFSKWKGTAPQCKALCQKPEVGNGTLSDEKDQYV

Feature

GlyTouCan Images

No data