Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: All-trans retinoic acid-induced differentiation factor (Fragment)
  • GlycoProtDB:GPDB0002684
  • UniProt:F6RYG0
  • Gene Symbol: Atraid
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
23 ---
57 22823882
23002422
117 22823882
135 22823882
146 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XLGVERALALPEICTLCPGGMHNLSRVAAYCEDTSKLMQARCCLNQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQPSPFYFGEPS

Feature

GlyTouCan Images

No data