Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carbonic anhydrase 4 (Fragment)
  • GlycoProtDB:GPDB0002694
  • UniProt:F6ST32
  • Gene Symbol: Car4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
73 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XMHIVHKKLTSSKEDSKDKFAVLAFMIEVGDKVNKGFQPLVEALPSISKPLRESSLQDMLPPSTKMYTYFRYNGSLTTPNCDETVIWTVYKQPIKIHKNQFLEFSKNLYYDEDQKLNMKDNVRPLQPLGKRQVFKSHAPGQLLSLPLPTLLVPTLTCLVANFLQ

Feature

GlyTouCan Images

No data