Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CAS1 domain-containing protein 1 (Fragment)
  • GlycoProtDB:GPDB0002706
  • UniProt:F6TUA2
  • Gene Symbol: Casd1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
128 22823882
23002422
140 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLGEKVWQPHSCMMHKYKISEAKTCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKDSVLKPHVIVAGAATWSIKIHNGSEEALAQYKMNITSIAPLLEKLAKTSDVYWVLQDPVYEDLLSENRKMITNEKI

Feature

GlyTouCan Images

No data