Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-2-macroglobulin receptor-associated protein (Fragment)
  • GlycoProtDB:GPDB0002732
  • UniProt:F6WMD1
  • Gene Symbol: Lrpap1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
64 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

XELHSDLKIQERDELNWKKLKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Feature

GlyTouCan Images

No data