Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Apolipoprotein N, isoform CRA_a
  • GlycoProtDB:GPDB0002897
  • UniProt:G3X9D6
  • Gene Symbol: Apon
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
25 17406563
22823882
23002422
187 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MIQAALLLGCILLSPVTAFPWKTQNGSLPAVTRTEPTSNVLPNKIPPPTPITCRDLLYTVLPAAPLSEFLSLLALRVVLENIGCPAEAYSLQLRISEMGGKDSAETLVLQSQKSSQEEGIGNNEVILRHLVPSPGDMRRVRRSVTLPEACTYEPGWVLYDMAQVLLETANKLPPIDLVREFKASVVNVTQHCTMESWESMNEVARRLMSSPELKDAKIPVEDRVYLVAQLAVVLKRIFVNLVWEYFQTYFG

Feature

GlyTouCan Images

No data