Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ATPase, Na+/K+ transporting, beta 2 polypeptide (Fragment)
  • GlycoProtDB:GPDB0002985
  • UniProt:I7HIF3
  • Gene Symbol: Atp1b2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
23 17406563
22823882
23002422
27 17406563
22823882
23002422
66 17406563
22823882
84 17406563
22823882
23002422
96 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

YSTGQPCVFIKMNRVINFYAGANQSMNVTCVGKRPQHYRDKGRLIPKDGRDEDAENLGHFVMFPANGSIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

Feature

GlyTouCan Images

No data