Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: ABPBG20
  • GlycoProtDB:GPDB0002991
  • UniProt:J3QK77
  • Gene Symbol: Scgb2b20
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
50 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKGTLLLLGLLVTGELSFQTTEACLPFFEGYASVLSGSRVWLYQELQAFNATAEEKVALEKIQDCYSEERIRNILLEPKIMEAMVASPECLSYYGLDNIRSILDYISKLLGE

Feature

GlyTouCan Images

No data