Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Asialoglycoprotein receptor 2 (Fragment)
  • GlycoProtDB:GPDB0002994
  • UniProt:J3QMY0
  • Gene Symbol: Asgr2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
62 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEK

Feature

GlyTouCan Images

No data