Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Asialoglycoprotein receptor 1 (Fragment)
  • GlycoProtDB:GPDB0003003
  • UniProt:J3QPT6
  • Gene Symbol: Asgr1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
46 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGF

Feature

GlyTouCan Images

No data