Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1,4-N-acetylhexosaminyltransferase
  • GlycoProtDB:GPDB0003009
  • UniProt:K0J1C6
  • Gene Symbol: Extl2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
74 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRGCHICKLPGRVMGIRVLRFSLVVILVLLLVAGALTNLLPNIKEDKMLTLRREIKSPSKSALDSFTLIMQTYNRTDLLLRLLNHYQAVPSLHKVIVVWNNVGEKGPEELWNSLGPHPIPVIFKPQTANKMRNRLQVFPEVETNAVLMVDDDTLISAQDLVFAFSIWQQFPDQIVGFVPRKHVSTSSGIYSYGGFELQTPGPGNGDQYSMVLIGASFFNSKYLELFQKQPAAVHALIDETQNCDDIAMNFLVTRHTGKPSGIFVKPINMVNLEKETNGYSGMWHRAEHFLQRSYCINKLVNIYDGMPLKYSNIMISQFGFPYANHKSKM

Feature

GlyTouCan Images

No data