Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Basigin
  • GlycoProtDB:GPDB0003014
  • UniProt:K3W4Q8
  • Gene Symbol: Bsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
99 22823882
23002422
135 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

Feature

GlyTouCan Images

No data