Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CAS1 domain-containing protein 1
  • GlycoProtDB:GPDB0003028
  • UniProt:M0QWG8
  • Gene Symbol: Casd1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
141 22823882
175 22823882
23002422
187 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCEYLLSSGRFLGEKVWQPHSCMMHKYKISEAKTCLVDKHIAFIGDSRIRQLFYSFVKIINPQFKEEGNKHENIPFEDKAASVKVDFLWHPEVNGSMKQCIKVWTEDSVLKPHVIVAGAATWSIKIHNGSEEALAQYKMNITSIAPLLEKLAKTSDVYWVLQECNDSHERVLQ

Feature

GlyTouCan Images

No data