Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Agrin (Fragment)
  • GlycoProtDB:GPDB0003060
  • UniProt:O08860
  • Gene Symbol: Agrn
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
111 ---

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

PGASGTCPERALERREEEANVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGIHFTAAPSMPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPAMVAPVCGSDAS

Feature

GlyTouCan Images

No data