Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD151 antigen
  • GlycoProtDB:GPDB0003116
  • UniProt:O35566
  • Gene Symbol: Cd151
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
159 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLATAYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY

Feature

GlyTouCan Images

No data