Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
  • GlycoProtDB:GPDB0003159
  • UniProt:O55003
  • Gene Symbol: Bnip3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
84 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

Feature

GlyTouCan Images

No data