Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Basigin (Fragment)
  • GlycoProtDB:GPDB0003165
  • UniProt:O55108
  • Gene Symbol: Bsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
28 17406563
22823882
23002422
138 22823882
23002422
174 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

RPAPAAAPPPCRLVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLDEDDPGAAPLKGSGTHMNDKDKNVRQRNAT

Feature

GlyTouCan Images

No data