Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD83 antigen
  • GlycoProtDB:GPDB0003203
  • UniProt:O88324
  • Gene Symbol: Cd83
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
87 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSQGLQLLFLGCACSLAPAMAMREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV

Feature

GlyTouCan Images

No data