Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cathepsin L1
  • GlycoProtDB:GPDB0003293
  • UniProt:P06797
  • Gene Symbol: Ctsl
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
221 17406563
22823882
268 17406563
22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MNLLLLLAVLCLGTALATPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVN

Feature

GlyTouCan Images

No data