Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1-acid glycoprotein 2
  • GlycoProtDB:GPDB0003304
  • UniProt:P07361
  • Gene Symbol: Orm2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
69 22823882
23002422
76 22823882
23002422
94 22823882
23002422
104 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MALHMILVMVSLLPLLEAQNPEHVNITIGDPITNETLSWLSDKWFFIGAAVLNPDYRQEIQKTQMVFFNLTPNLINDTMELREYHTIDDHCVYNSTHLGIQRENGTLSKYVGGVKIFADLIVLKMHGAFMLAFDLKDEKKRGLSLNAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCSQQEKQQLELEKETKKDPEEGQA

Feature

GlyTouCan Images

No data