Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cathepsin B
  • GlycoProtDB:GPDB0003332
  • UniProt:P10605
  • Gene Symbol: Ctsb
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
38 17406563
22823882
23002422
192 17406563
22823882
23002422
208 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MWWSLILLSCLLALTSAHDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF

Feature

GlyTouCan Images

No data