Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Antigen-presenting glycoprotein CD1d1
  • GlycoProtDB:GPDB0003352
  • UniProt:P11609
  • Gene Symbol: Cd1d1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
38 17406563
22823882
23002422
60 17406563
22823882
23002422
183 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSADGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR

Feature

GlyTouCan Images

No data