Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-defensin-related sequence 1
  • GlycoProtDB:GPDB0003443
  • UniProt:P17533
  • Gene Symbol: Defa-rs1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
100 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKTLVLLSALVLPCFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFPWCRKCRVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC

Feature

GlyTouCan Images

No data