Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Asialoglycoprotein receptor 2
  • GlycoProtDB:GPDB0003511
  • UniProt:P24721
  • Gene Symbol: Asgr2
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
165 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MEKDCQDIQQLDSEENDHQLSGDDEHGSHVQDPRIENPHWKGQPLSRPFPQRLCSTFRLSLLALAFNILLLVVICVVSSQSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Feature

GlyTouCan Images

No data