Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-2-HS-glycoprotein
  • GlycoProtDB:GPDB0003548
  • UniProt:P29699
  • Gene Symbol: Ahsg
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
99 17406563
22823882
156 17406563
22823882
23002422
176 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKSLVLLLCFAQLWGCQSAPQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKI

Feature

GlyTouCan Images

No data