Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Apolipoprotein D
  • GlycoProtDB:GPDB0003679
  • UniProt:P51910
  • Gene Symbol: Apod
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
65 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MVTMLMFLATLAGLFTTAKGQNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL

Feature

GlyTouCan Images

No data