Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Atypical chemokine receptor 3
  • GlycoProtDB:GPDB0003708
  • UniProt:P56485
  • Gene Symbol: Ackr3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
192 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRVVCILVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK

Feature

GlyTouCan Images

No data