Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Aquaporin-1
  • GlycoProtDB:GPDB0003863
  • UniProt:Q02013
  • Gene Symbol: Aqp1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
42 22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MASEIKKKLFWRAVVAEFLAMTLFVFISIGSALGFNYPLERNQTLVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAVMYIIAQCVGAIVATAILSGITSSLVDNSLGRNDLAHGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVLTRNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDFTDRMKVWTSGQVEEYDLDADDINSRVEMKPK

Feature

GlyTouCan Images

No data