Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Biliary glycoprotein (Fragment)
  • GlycoProtDB:GPDB0003877
  • UniProt:Q03679
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
42 ---
52 ---
123 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

PGSNLNLSCHAASNPPAQYFWLINEKPHASSQELFIPNITTNNSGTYTCFVNNSVTGLSRTTVKNITVLEPVTQPSLQVTNTTVKELDSVTLTCLSNDIGANIQWLFNSQSLQLTERMTLSQNNSILRIDPIKREDAGEYQCEISNPVSVKRSNSIKLDIIFDPTQGGLSDGAIAGIVIGAVAGVALIAGLAYFLYSRKSGGSGSF

Feature

GlyTouCan Images

No data