Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-1,4-galactosyltransferase
  • GlycoProtDB:GPDB0003959
  • UniProt:Q0R0H6
  • Gene Symbol: A4galt
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
198 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSKPPDCLLRMLRGTPRQRVFTFFIISFKFMFLISILIYWHTVGAPKDQREYSLPVDFSCPQLAFPRVSAPGNIFFLETSDRTSPNFLFMCSVESAARAHPESQVVVLMKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELFEDTPLAAWYSEARHRWEPYQLPVLSDASRIALLWKFGGIYLDTDFIVLKNLLNLTNTLGIQSRYVLNGAFLAFERKHEFLALCLHDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEKSHACRGVTALPPEAFYPIPWQNWKKYFEDISPEELTQLLNATYAVHVWNKKSQGTHLEATSKALLAQLHARYCPTTHRAMKMYL

Feature

GlyTouCan Images

No data