Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alkaline phosphatase (Fragment)
  • GlycoProtDB:GPDB0003969
  • UniProt:Q0VD75
  • Gene Symbol: Alpi
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
427 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

QGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAVKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLLVSMLLLVGTAMVVS

Feature

GlyTouCan Images

No data