Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha-(1,3)-fucosyltransferase 4
  • GlycoProtDB:GPDB0003990
  • UniProt:Q11127
  • Gene Symbol: Fut4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
117 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAPARQELQHESRCRPSRTVDAWRAAVATRGRHMETPGYRRRTRCGGWGLPRSVSSLAAVGLLCTALTTFICWGQLPPLPWASPAPQRLVGVLLWWEPFRGRGGYPKSPPDCSLRFNISGCRLLTDRAAYGEAQAVLFHHRDLVKELHDWPPPWGARERTDKALVLRVFDDQEGAVTLTGKALETVGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWTLSYRTDSDVFVPYGFLYSRSDPTEQPSGLGPQLARKRGLVAWVVSNWNEHQARVRYYHQLSRHVSVDVFGRTGPGRPVPAIGLLHTVARYKFYLAFENSRHVDYITEKLWRNAFLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPNAASLAAYLLFLDRNVAVYRRYFRWRRSFAVHITSFWDEQWCRTCQAVQTSGDQPKSIHNLADWFQR

Feature

GlyTouCan Images

No data