Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C-type lectin domain family 12 member B
  • GlycoProtDB:GPDB0004002
  • UniProt:Q149M0
  • Gene Symbol: Clec12b
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
91 22823882
97 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MSDEVTYATLMLQDSARVRGNQDGNNLRKEGHPAQSSLWRGAALSLMTLCLVLVTGLVTLATMFLQVSNDINSDSEKLSQLQKSIHPQQDNLSESLNSSRKSLTEESLQSQISALLERQEQMATKLCKEFLIHASDHKCNPCPKTWQWYGNSCYYFSINEEKSWSDSRKDCIDKNATLVKIDSTEERDLLQSQLSLTFSFFWLGLSWNSSGRNWLWEDGSFPPPTLFSDKELASFNGSRDCAYFERGNIYASRCSAEIPWICEKTASLVKTEDLD

Feature

GlyTouCan Images

No data