Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CAR-like soluble protein
  • GlycoProtDB:GPDB0004044
  • UniProt:Q1RME4
  • Gene Symbol: Gm1123
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
93 22823882
232 22823882
357 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MVFLLGFLFLCGVTDHIGSVSITTPEQTIQEVQGETVHLPCMFTLSPEDQGPLDIEWLRLSGPNNEAMDHVIILYAVDKIYSDFYQDMRGRVNFTSNGITSGEASIKIRDVQPADSGTYLCKVKTAPGVAKTTVQLTVVDYIGSVSITTPEQTIEKDQGETVHLPCMFTFISKDQGPLNIEWLRLSGPNNEAMDHVVILYSADKIHDDVYPDLKGRVYFTSNDIKSGDASINITNVQLSDAGTYQCKVKTYPGTVNRNLQLAVTDHIGSVSITTPEQTIQKARGETVHLPCTFTLSPEDHGPLFIDWMQLTGPQNEVVNRMFIVYLADKIYDNFYQDMKGRVQFTSNDIRSGEASINITDARLSDAGTYQCGVSHAFGTAKGTIQLTVVG

Feature

GlyTouCan Images

No data