Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Atp1b3 protein (Fragment)
  • GlycoProtDB:GPDB0004048
  • UniProt:Q1WWL1
  • Gene Symbol: Atp1b3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
53 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

ACVQLLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPDGYPQISCLPKEENATIATYPEFGVLDLKYFPYYGKKRHVGYRQPLVAVQVKFDSGLNKKEVTVECHIAGTRNLKNKNERDKFLGRVSFKVTARA

Feature

GlyTouCan Images

No data