Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carcinoembryonic antigen-related cell adhesion molecule 1
  • GlycoProtDB:GPDB0004126
  • UniProt:Q3LFS7
  • Gene Symbol: Ceacam1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
71 17406563
22823882
89 17406563
22823882
23002422
104 22823882
23002422
199 23002422
206 17406563
22823882
23002422
210 17406563
22823882
23002422
226 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MELASAHLHKGQVPWGGLLLTASLLASWSPATTAEVTIEAVPPQVAEDNNVLLLVHNLPLALGAFAWYKGNTTAIDKEIARFVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMKDMGVYTLDMTDENYRRTQATVRFHVHPILLKPNITSNNSNPVEGDDSVSLTCDSYTDPDNINYLWSRNGESLSEGDRLKLSEGNRTLTLLNVTRNDTGPYVCETRNPVSVNRSDPFSLNII

Feature

GlyTouCan Images

No data