Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Cathepsin C, isoform CRA_a
  • GlycoProtDB:GPDB0004631
  • UniProt:Q3U7T5
  • Gene Symbol: Ctsc
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
53 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKDVTDFISQLFMQLGTVGMYDLPHLRNKLVIK

Feature

GlyTouCan Images

No data