Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Alpha 1,4-galactosyltransferase
  • GlycoProtDB:GPDB0004746
  • UniProt:Q3UF00
  • Gene Symbol: A4galt
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
209 23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MGISCSHLEETMSKPPDCLLRMLRGTPRQRVFTFFIISFKFMFLISILIYWHTVGAPKDQREYSLPVDFSCPQLAFPRVSAPGNIFFLETSDRTSPNFLFMCSVESAARAHPESQVVVLMKGLPRDTTAQPRNLGISLLSCFPNVWIRPLDLQELFEDTPLAAWYSEARHRWEPYQLPVLSDASRIALLWKFGGIYLDTDFIVLKNLLNLTNTLGIQSRYVLNGAFLAFERKHEFLALCLHDFVANYNGWIWGHQGPQLLTRVFKKWCSIQSLEKSHACRGVTALPPEAFYPIPWQNWKKYFEDISPEELTQLLNATYAVHVWNKKSQGTHLEATSKALLAQLHARYCPTTHRAMKMYL

Feature

GlyTouCan Images

No data