Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Amino acid transporter
  • GlycoProtDB:GPDB0004910
  • UniProt:Q3US35
  • Gene Symbol: Slc1a4
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
201 17406563
22823882
23002422
206 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MEKSGETNGYLDGTQAEPAAGPRTPETAMGKSQRCASFFRRHALVLLTVSGVLVGAGMGAALRGLQLTRTQITYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASSLGRLGGIAVAYFGLTTLSASALAVALAFIIKPGAGAQTLQSSSLGLENSGPPPVSKETVDSFLDLLRNLFPSNLVVAAFTTSATDYTVVTHNTSSGNVTKEKIHVVTDVEGMNILGLVLFALVLGVALKKLGPEGEDLIRFFNSFNEATMVLVSWIMWYVPIGIMFLIGSKIVEMKDIVMLVTSLGKYIFASMLGHVIHGGIVLPLVYFAFTRKNPFTFLLGLLTPFATAFATCSSSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVDLNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLSLILAVDWIVDRTTTVVNVEGDALGAGILNHLNQKVVKKGEQELQEVKVEAIPNSKSEEETSPLVTHQNPAGPVAIAPELESKESVL

Feature

GlyTouCan Images

No data