Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: 11B-hydroxysteroid dehydrogenase type 1
  • GlycoProtDB:GPDB0005122
  • UniProt:Q4JHD9
  • Gene Symbol: Hsd11b1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
162 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MAVMKNYLLPILVLFLAYYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKMTQPMIAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKEISGIINAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMFVSN

Feature

GlyTouCan Images

No data