Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: C920025E04Rik protein
  • GlycoProtDB:GPDB0005169
  • UniProt:Q52L73
  • Gene Symbol: C920025E04Rik
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
106 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MLLFAHLLQLLVSATVPTQSSSHSLRYFHTAMSRPGLGEPRFIVVGYVDDTQFVSFDSDSENPKMEPRARWMEQEGPEYWERETWKARDMGRNFRVNLRTLLGYYNQSKDESHTLQWMYGCDVGPDGRLLRGYCQEAYDGQDYISLNEDLRSWTATDFASQISKHKSEMVDEAHQQRAYLQGPCVEWLHTYLRLGALVHWAISPALCRS

Feature

GlyTouCan Images

No data