Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD90.1
  • GlycoProtDB:GPDB0005176
  • UniProt:Q53YX2
  • Gene Symbol: Thy1
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
42 17406563
22823882
94 17406563
22823882
23002422

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MNPAISVALLLSVLQVSRGQKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELRVSGANPMSSNKSISVYRDKLVKCGGISLLVQNTSWMLLLLLSLSLLQALDFISL

Feature

GlyTouCan Images

No data