Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Carboxypeptidase A3, mast cell
  • GlycoProtDB:GPDB0005183
  • UniProt:Q542E3
  • Gene Symbol: Cpa3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
242 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MRFFLLMAVIYTTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDAIHDIAVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQFDVKDEIAGRHSYAKYNDWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVYDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYILKNTS

Feature

GlyTouCan Images

No data