Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CD34 antigen, isoform CRA_b
  • GlycoProtDB:GPDB0005190
  • UniProt:Q543B6
  • Gene Symbol: Cd34
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
246 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MQVHRDTRAGLLLPWRWVALCLMSLLHLNNLTSATTETSTQGISPSVPTNESVEENITSSIPGSTSHYLIYQDSSKTTPAISETMVNFTVTSGIPSGSGTPHTFSQPQTSPTGILPTTSDSISTSEMTWKSSLPSINVSDYSPNNSSFEMTSPTEPYAYTSSSAPSAIKGEIKCSGIREVRLAQGICLELSEASSCEEFKKEKGEDLIQILCEKEEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSKLQLMEKHQSDLRKLGIQSFNKQDIGSHQSYSRKTLIALVTSGVLLAILGTTGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGASPETQGKANVTRGAQENGTGQATSRNGHSARQHVVADTEL

Feature

GlyTouCan Images

No data