Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: Brain cDNA, clone MNCb-5810, similar to Mus musculus tissue inhibitor of metalloproteinase 3 (Timp3), mRNA
  • GlycoProtDB:GPDB0005252
  • UniProt:Q54AE5
  • Gene Symbol: Timp3
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
207 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MTPWLGLVVLLSCWSLGHWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP

Feature

GlyTouCan Images

No data