Glycoprotein entry

Extracted Glycoprotein from GlycoProtDB

  • Protein: CRS1C-2
  • GlycoProtDB:GPDB0005304
  • UniProt:Q5ERJ0
  • Gene Symbol: Gm14851
  • Organism:
    • Scientific Name: Mus musculus

Glycosylation

Position PubMed ID
100 22823882

Sequence

[ ___:Potential Sequon , N:Glycosylation Site from GlycoProtDB ]

MKTLVLLSALALLAFQVQADPIQNTDEETKTEEQPEEEDQAVSVSFGGTEGSALQDVAQRRFLWCRKCPVCQKCQVCQKCPVCPTCPQCPKQPLCEERQNKTAITTQAPNTQHKGC

Feature

GlyTouCan Images

No data